PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Solyc08g008660.2.1
Common NameLOC101267143
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Solanoideae; Solaneae; Solanum; Lycopersicon
Family NAC
Protein Properties Length: 350aa    MW: 40182.7 Da    PI: 6.2991
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Solyc08g008660.2.1genomeITAGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1584e-49111391128
                 NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                         +ppGfrFhPt+eel+++yL+kk++++k++l +vi+evd++k+ePwd+++k+k     +++wy Fs++dkky++g+r+nrat++g+Wkatg+
  Solyc08g008660.2.1  11 VPPGFRFHPTEEELLHYYLRKKIANEKIDL-DVIREVDLNKLEPWDIQEKCKIgstPQNDWYLFSHKDKKYPSGSRTNRATAAGFWKATGR 100
                         69****************************.9***************964444222455******************************** PP

                 NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                         dk ++  + + +g++ktLvfykgrap+g k dW+mheyrl
  Solyc08g008660.2.1 101 DKVIYG-NCKRIGMRKTLVFYKGRAPHGLKLDWIMHEYRL 139
                         *****9.8889***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.88E-558173IPR003441NAC domain
PROSITE profilePS5100554.23711173IPR003441NAC domain
PfamPF023654.5E-2612139IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 350 aa     Download sequence    Send to blast
MNLSVNGQSQ VPPGFRFHPT EEELLHYYLR KKIANEKIDL DVIREVDLNK LEPWDIQEKC  60
KIGSTPQNDW YLFSHKDKKY PSGSRTNRAT AAGFWKATGR DKVIYGNCKR IGMRKTLVFY  120
KGRAPHGLKL DWIMHEYRLD DISTPQHQPS LNFCASESAA LEEGWVVCRV FKKKSTLQSS  180
SAVSKTLIHE NTNTHHDGVL DQILMYMGRS SKQQQQHEIK SNNIVQQVNN NDNENIQFDN  240
TEDGFLQLPE LVNHHQDCNF NDEMIIMSTG NDDQHYSCMI NNYQENNEAA DHKKNGPTCD  300
WLAMVASQLN GHHLEPPTNN NTTRSNDDDV EFWSYAQSST FDPLSQFTV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-49817814170NAC domain-containing protein 19
4dul_A9e-49817814170NAC domain-containing protein 19
1ut7_B9e-49817814170NO APICAL MERISTEM PROTEIN
1ut7_A9e-49817814170NO APICAL MERISTEM PROTEIN
1ut4_B9e-49817814170NO APICAL MERISTEM PROTEIN
1ut4_A9e-49817814170NO APICAL MERISTEM PROTEIN
3swp_D9e-49817817173NAC domain-containing protein 19
3swp_C9e-49817817173NAC domain-containing protein 19
3swp_B9e-49817817173NAC domain-containing protein 19
3swp_A9e-49817817173NAC domain-containing protein 19
3swm_D9e-49817817173NAC domain-containing protein 19
3swm_C9e-49817817173NAC domain-containing protein 19
3swm_B9e-49817817173NAC domain-containing protein 19
3swm_A9e-49817817173NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004244660.10.0PREDICTED: NAC domain-containing protein 66-like
SwissprotQ84WP61e-100NAC43_ARATH; NAC domain-containing protein 43
TrEMBLK4CJ000.0K4CJ00_SOLLC; Uncharacterized protein
STRINGSolyc08g008660.2.10.0(Solanum lycopersicum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA13424297
Representative plantOGRP1715800
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-101NAC family protein
Publications ? help Back to Top
  1. Wang Y,van der Hoeven RS,Nielsen R,Mueller LA,Tanksley SD
    Characteristics of the tomato nuclear genome as determined by sequencing undermethylated EcoRI digested fragments.
    Theor. Appl. Genet., 2005. 112(1): p. 72-84
    [PMID:16208505]